PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc03896.1.g00010.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 615aa    MW: 65347.7 Da    PI: 6.6178
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc03896.1.g00010.1.sm.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.42.1e-07270308543
                                   SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHH CS
                      Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterq 43 
                                   +++t++q ++Le++F  + +p++++r+eL +  gL+e+q
  Zpz_sc03896.1.g00010.1.sm.mk 270 QRLTSQQSQILESFFSTCAHPTEAQRKELVETAGLSENQ 308
                                   5789*********************************98 PP

2START101.71.3e-323505633206
                                   HHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS....SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT- CS
                         START   3 aeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv...dsgealrasgvvdmvlallveellddkeqWdetl 76 
                                   a  a  e+v++a ++ p+W++ +    e +n + +l  f+ + +    ++ea ra +vv   +  +ve l+dd   + + +
  Zpz_sc03896.1.g00010.1.sm.mk 350 AKNAVHEFVTMANSDGPMWMSAPggslETLNMMAYLHAFPGQSSaigLQMEANRANAVVMLGSKSVVEFLMDDE-SYGTFF 429
                                   677899*********************************665559*****************************.999999 PP

                                   S.......EEEEEEEECTT..EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EE CS
                         START  77 a.......kaetlevissg..galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRael 147
                                   +         ++++   +g  gal+  + e++++sp+vp R+ +f+R++ +l++g  +ivd+Svd  +       ++++++
  Zpz_sc03896.1.g00010.1.sm.mk 430 PgilsvaaTTKVYNWPPNGydGALEMVTVEMVFPSPVVPaRKCTFLRHCTTLEDGATAIVDISVDDGEGT-----FIKCHK 505
                                   9888866556666666777**********************************************99883.....8***** PP

                                   SSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                         START 148 lpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                     Sgili+p   + +kvt++ehv l++  +h l+r+ + sgl +ga++ v  + rqc++
  Zpz_sc03896.1.g00010.1.sm.mk 506 MASGILIQPIRSNTCKVTVIEHVRLEDTGIHDLFRPCL-SGLLFGARRLVMSMARQCAR 563
                                   ************************************98.699**************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5148537.73328140IPR003245Phytocyanin domain
SuperFamilySSF495038.33E-2928139IPR008972Cupredoxin
CDDcd110191.32E-5228139No hitNo description
Gene3DG3DSA:2.60.40.4203.9E-3129143IPR008972Cupredoxin
PfamPF022981.8E-2055131IPR003245Phytocyanin domain
ProDomPD0031221.0E-2674138IPR003245Phytocyanin domain
Gene3DG3DSA:1.10.10.604.1E-9253308IPR009057Homeodomain-like
SuperFamilySSF466892.48E-7259309IPR009057Homeodomain-like
SMARTSM003890.0073265321IPR001356Homeobox domain
PfamPF000465.0E-5270308IPR001356Homeobox domain
CDDcd000861.56E-6270308No hitNo description
PROSITE profilePS5084821.712339554IPR002913START domain
CDDcd088755.68E-71345562No hitNo description
SuperFamilySSF559612.88E-18347531No hitNo description
SMARTSM002341.8E-17348563IPR002913START domain
PfamPF018524.0E-25351563IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
GO:0009055Molecular Functionelectron carrier activity
Sequence ? help Back to Top
Protein Sequence    Length: 615 aa     Download sequence    Send to blast
MARGRSCRLF LACVVAVAAV SAPQASGFVF KAGGTGEWRV PAASSGGNAN ANATGAYNAW  60
AQRNRFRVGD AIAFTYQAGN DSVLLVDQRS YDACDTSSPI DTFSDGSTVF TFTRSGPYYF  120
ISGSKDNCNR GEKLIVVVMA ERSTVDNGTQ PITGMAPAPN GPFSPFSPPP PPFGIDISPA  180
ANPPPPNAAS CKVAGGAGAV ALAIGAMFYA LCEASERSPS DPEIVHATNA AAALGITEVD  240
SRSSINNRNI HEGAHGSGQN GPQAKKNIHQ RLTSQQSQIL ESFFSTCAHP TEAQRKELVE  300
TAGLSENQLT RLKSELPINL PALNRGFPLE TSSENEFVRI DDARVLAGIA KNAVHEFVTM  360
ANSDGPMWMS APGGSLETLN MMAYLHAFPG QSSAIGLQME ANRANAVVML GSKSVVEFLM  420
DDESYGTFFP GILSVAATTK VYNWPPNGYD GALEMVTVEM VFPSPVVPAR KCTFLRHCTT  480
LEDGATAIVD ISVDDGEGTF IKCHKMASGI LIQPIRSNTC KVTVIEHVRL EDTGIHDLFR  540
PCLSGLLFGA RRLVMSMARQ CARIRDVFHV ANSSTSGNTV NLQCPTATSN THNHTLTGPE  600
SPALFQSARK EGRSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660716.11e-106PREDICTED: homeobox-leucine zipper protein TF1
TrEMBLK3XF211e-106K3XF21_SETIT; Uncharacterized protein
STRINGSi000488m1e-106(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104752833
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.12e-41protodermal factor 2